描述
App Information Swedish Newspapers
- App NameSwedish Newspapers
- 包名svenskamedia.swedishnewspapers
- 发布日期May 18, 2016
- 文件大小Undefined
- 系统要求Android 4.0.3 and up
- 版本1.4
- 开发者World News & Translators
- 安装10 - 50
- 价钱免费
- 分类News & Magazines
- 开发者
- Google Play Link
World News & Translators 更多...
Bengali English Translator 1.9 APK
Bengali English Translator App lets youtranslate Bengali to English, English to Bengali and Bengali tomore than 20 other languages.Now easily translate Bengali to the following languagesBengali To EnglishEnglish To BengaliBengali To ChineseBengali to SpanishBengali to MandarinBengali to HindiBengali to ArabicBengali to PortugueseBengali to RussianBengali to JapaneseBengali to GermanAnd many more.If you have questions or suggestions, please email us @play.eflair@gmail.com
Swedish Newspapers 1.4 APK
Sweden Newspapers - Read all the topSwedishNewspapers in a single app. We have included the most readandhigly popular newspapers of the country. We have also includedsomeworldwide read publications for you to keep a tab on.List of Sweden newspapers :Swedish :AllehandaOPAlingsastidningNWTBarometernBltBohuslaningenGPGoteborgsfriaInternational :ForbesWall Street JournalNewYork TimesBBCThe GuardianMashableHuffington PostCNNYahoo NewsFox NewsIf you have any comments or questions, mail us at-play.eflair@gmail.com
Gaming News 1.0 APK
Gaming News - Read all the happens fromtheworld of gaming from leading websites all in a single app.We have covered everything from PC, Xbox One/360, PS4, PS3andWii game news and reviews.List of Gaming websites supported :GamespotIGNKotakuPC GamerRock Paper ShotGunNeo SeekerVG247PolygonN4GEuro GamerMetacriticThe app is developed in material design and has simplefeatureslike bookmarks etc.Feel free to contact us for any quires-play.eflair@gmail.com
Botswana Newspapers 2.0 APK
Botswana Newspapers - Read thehighestcirculated Botswana news papers for free. Also readInternationalnewspapers in a fast and small app.List of newspapers :Botswana Newspapers :BotswanaguardianThe VoicebwThe midweek SunThe PatriotSunday StandardAll AfricaNTAWeekend PostMmegiInternational :ForbesWall Street JournalNewYork TimesBBCThe GuardianMashableHuffington PostCNNYahoo NewsFox NewsIf you have any comments or questions, mail us at-play.eflair@gmail.com
Czech Newspapers 1.7 APK
Czech Republic Newspapers - Read yourfavoriteCzech Republic News papers in Czech. Also read EnglishNewspapersof Czech Republic and International newspapers in onesmallapplication.List of newspapers :Czech :DenikNarodninovinyRegionyCzech TodayNarodninovinyIdnesBleskPravoEnglish :CzechjournalThe DailyPbjPraguemonitorTolMetroInternational :ForbesWall Street JournalNewYork TimesBBCThe GuardianMashableHuffington PostCNNYahoo NewsFox NewsIf you have any comments or questions, mail us at-play.eflair@gmail.com
Indonesian Newspapers 1.5 APK
Indonesian Newspapers - Read the topnewspapers of Indonesia in both Indonesian and English languages.Alsoread the most read International newspapers in this app.List of Indonesian news papers in this app:Indonesian :BisnisBeritasatuJwaposKompasKoran-JakartaKontanSuarapembaruanSuarakaryaRepublikaTempoEnglish :InsideindonesiaJakartaglobe BeritasatuTempoThe PresidentpostThe JakartapostInternational :ForbesWall Street JournalNewYork TimesBBCThe GuardianMashableHuffington PostCNNYahoo NewsFox NewsIf you have any comments or questions, mail us at-play.eflair@gmail.com
Urdu Newspapers India 1.9 APK
Urdu Newspapers - Read all Urdu NewspapersofIndia, Enligsh & also International publications in superlite& fast application.List of Urdu newspapers :Urdu :SiasatEtemaadSahilKashmiruzmaSiyasi TaqdeerChauthi DuniyaSalar hindEnglish :The HinduGoogle NewsThe Indian ExpressHindustan TimesTimes Of IndiaDNALive MintDeccan ChronicleBusiness StandardThe Economic TimesInternational :ForbesWall Street JournalNewYork TimesBBCThe GuardianMashableHuffington PostCNNYahoo NewsFox NewsIf you have any comments or questions, mail us at-play.eflair@gmail.com
Malayalam English Translator 1.2 APK
Malayalam English Translator App lets youtranslate Malayalam to English, English to Malayalam and Malayalamto more than 20 other languages.Now easily translate Malayalam to the following languagesMalayalam To EnglishEnglish To MalayalamMalayalam To ChineseMalayalam to SpanishMalayalam to MandarinMalayalam to HindiMalayalam to PortugueseMalayalam to RussianMalayalam to JapaneseMalayalam to GermanAnd many more.If you have questions or suggestions, please email us @play.eflair@gmail.com
猜你喜欢 更多...
Sweden Newspaper 1.0 APK
Sweden NewspaperRSS feeds offer another way to get Sweden content. Subscribe toourfeeds to get the latest headlines summaries and links back tofullarticles formatted for your favorite feed reader andupdatedthroughout the day.In App you can find the information and this topic below.1. Economy News2. Politics News3. Sport News4. Sweden NewsInstall it Now!!!!
Sverige Tidningar 1.0 APK
Sverige Tidningar ★★★★★Välkommen till det bästa Sverige nyheten appDetta är den bästa APP i kategorin, Sverige tidningarna;✪ Ställ favoriter, kan denna funktion dig attorganisera dina tidningar med favoriter.✪ Lägg till tidningar, tidskrifter✪ Radera tidning, tidskrift✪ Justerbar teckenstorlek inom app✪ Öppna med standard webbläsare✪ Sverige tidningar på App:★ Aftonbladet★ Expressen★ mobil★ di★ DN★ SvD★ Allehanda★ Dagen★ lokal★ Göteborgs-Posten★ VLT★ jnytt★ metro★ Nerikes Allehanda★ Kristianstadsbladet★ Norran★ Barometern★ Dagens Industri★ Eskilstuna-Kuriren★ Arbetarbladet★ e24★ FolkbladetOch många fler. Om du inte kan hitta dina favorit tidningar,precisanpassa programmet till dina behov.Eller skicka ett mail till oss.[P.S;! Ta app nu medan det fortfarande gratis]
Svenska Tidningar 1.0 APK
It consists of Swedish's leading newspapersforyou to keep up Swedish news throughout the day.News included:Skanska Dagbladet Skanskan, Nya Lans-Tidningen,Aftonbladet,Expressen, DN, SvD Svenska Dagbladet, GP, The Local,Fria Tider,Avpixlat, Nyheter24, Blogg, Metro, Dagens Media,Sydsvenskan,Helsingborgs Dagblad, omni, VK Vasterbottens-Kuriren,iFokus andST.
📰Sweden News-Sweden News 24H 1.0.2 APK
If you need to be always aware of what’s happening in Sweden Cityand the there major cities in the country, looking for specificevents in other states and Municipalities and you’re not willing towaste time browsing on each newspaper website or buying thenewspapers of each editorial; this is the perfect app for you. Getinstant access to the most relevant news minute by minute, alwaysupdated information available 24 hours, the 7 days of the week.Browse easily trough the wide variety of newsfeed and sources we’veintegrated selecting them from the list, and get instantnotifications when some relevant news are available for you toread. Read about your favorite Sweden national team, soccerleagues, the Sweden reaction to the Obama immigration news, and allthe politic implications abut Donald Trump and the border wall. Notinto politics? Be aware of the show industry latest gossips incelebrities sections from different sources. Try now the best appthat will keep you always informed! 🗞📲🗞 Read the Latest News AlwaysAvailable for You Straight into your Android Device! Be aware ofEverything Happening in the Country from the Best Newspapers andOther Sources for FREE! Download Sweden News-Sweden News 24HAvailable NOW for FREE! Limited Time Only Special Offer! 🗞📲🗞 Easyto use & fast browsing. You’ll be able to see also the images,photographs and cartoons published in the most recognizednewspapers of the country like: Aftonbladet DT.se HelsingborgsDagblad NA SN.se Sydsvenskan DI GP Metro Privata Affärer SverigesRadio BBC Expressen IDG Norran SN24 DN Hallands Nyheter MSNBCSkövde Nyheter SVT Corren.se and many More! We also included thelocal Newspapers from almost all the states and municipalities.Economy News are also available with El Economista & ElFinanciero. Share an important new to your friends and family byFacebook, Email, SMS, WhatsApp and other Social Media andMessengers. Not willing to receive many notifications? Removesources or topics from the list to receive only the bestinformation that suits your interests. Save articles on your devicefor reading them later, even if you don’t have internet connection.📰📩📰 Get the Most Complete & Up-to-the-minute daily breakingnews, Headlines, Sports and everything about your favorite Swedensoccer team with: Sweden News-Sweden News 24H FREE NOW!!!📰📩📰 If youhave family living in the country, you are from Sweden or if youare willing to travel to Sweden, this app will really satisfy allyour information and need to be always updated with the mostrelevant information. Setup easily your preferences to get intoyour phone and get only the information that matters the most foryou choosing from a wide variety of topics and even you can programthe app for sending notifications regarding new information about aspecific celebrity of public figure. You’ll never miss again abreaking new from the Sweden cartels, current events and everythingabout Sweden day to day life. 👓🔔👓 Enjoy all the Daily Events andNewsfeeds, Read all Interesting Articles and Columns from the mostprestigious Sources of the Republic of Sweden. Download Now forFREE Sweden News-Sweden News 24H Available in Google Play Store!👓🔔👓 Features: 🗞 Unlimited Access to All Sources 🗞 Keep YourselfUpdated with the Most Popular Trends 🗞 Watch Videos of Coveragesand Specials from All Newspapers 🗞 All Content is Free 🗞Notifications and Relevant Information 24/7 🌟 Get NOW for FREE thisUnique News App and Stay Always Aware of Sweden Doings DownloadSweden News-Sweden News 24H 🌟
新闻杂志 热门 更多...
Eenadu - official news app 3.0.0 APK
Please note: This app is curatedbyEenadueditors. It has all the content of the e-paper and more,andistotally free to useEenadu (Hyderabad, Telangana and Andhra Pradesh) -officialfreeapp connects you to your favorite TeluguLanguagenewspaperanywhere you are, anytime you want to read it. TheEenaduappoffers everything a Telugu news reader is looking for.Get24/7access to breaking news on politics,business,entertainment,technology, district news, sports andlifestyle. Andmuchmore...The Eenadu app also allows you to get more out of your copyoftheprinted Eenadu news paper. Seamlessly integratingtheprint(offline medium) with the digital (online) space is avisualsearchcapability which lets you discover the story behind animage.Click on enabled editorial or advertising imagesinEenaduNewspaper with your phone camera and getrelevantinformation. Youcould even take part in polls and quizzesbyclicking on theseimages.Features:* 24X7 access to the latest news from Andhra Pradesh,TelanganaandHyderabadNews, in a flash- breaking news updates by the minute* Comprehensive coverage of trending articles-relatedcontent:articles, videos, photos etc.* Breaking news notifications* Follow your district with personalizeddistrictspecificnews.* Check on your daily horoscope* Image enabled Polls and Quizzes* Visual search- click on the images in the newspaper tofindrelatedarticles.* Shopping, Click and Buy: click on the image in thenewspaperandshop online instantly.* Print Ads in the Newspaper can be clickedformoreinformation.* Share what matters to you via email, fb twitter etc.* Create your own library- save articles and organisethemintofolders* Read articles offline. Downloaded or saved articles canbeaccessedoffline too.Please Note: Eenadu Mobile app does not work onMicromaxwithAndroid versions less other than Lollipop
Narendra Modi 2.1 APK
App of Prime Minister of India,NarendraModi.It brings to you latest information, instant updates&helpsyou contribute towards various tasks. It providesauniqueopportunity to receive messages and emails directly fromthePrimeMinister.Download the app and get the latest updates anywhere,anytime!Narendra modi news todayPMO APPHighlights of the Narendra Modi app:• Receive the latest news and updates• Exclusive opportunity to receive E-Mails &Messagesdirectlyfrom the PM.• 'Mann Ki Baat' with the PM.• Small Tasks, Big Satisfaction: Contribute & earnBadgesthroughto-do tasks.• Your chance to Interact with the PM & shareIdeas&Suggestions.• Never miss out thoughts from PM Modi, read his Blogs.• Know more about PM Narendra Modi through unique insightsintheBiography section.• Read about PM Modi’s Governanceinitiatives&achievements.• Learn more about PM Modi’s efforts augmentingIndia’sGlobalRecognition.• Know about how Good Governance is improvinglivesthroughInfographics.Real Digital India App.This is informational ApplicationforModilovers,This is the perfect app to have a Shri NarendraModiworksand his informations.This is true digital India :)So register with the application to get best results.Key Features -* Different government portal on-line* Direct connect to Mr. Modi* All social connection at one place* Man ki baat ,digital India,live chat with PM.* Easy to Narendra Modi (Indian PM) details shareBest Digital India.Note: Best results in 3G network.DISCLAIMER: This is un-Official App of Prime MinisterofIndia,Narendra Modi.The content provided in this application is hosted on NICIndiaandis available in the public domain also. We have notuploadedanyvideos or any type of content. This application isjustanorganized way to browse and view NIC India portals likeMyGOV,MakeIN India,Maan ki Baat etc in another way.